LDHC Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LDHC

Key Reference: Sharma,P.R., (2007) Clin. Biochem. 40 (18), 1414-1419

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: L-lactate dehydrogenase C chain

Protein Size: 332

Purification: Affinity Purified

• Artikelnummer: AVIARP53602_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53602_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3948
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin