LDLRAP1 Antibody - N-terminal region : FITC

LDLRAP1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55308_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LDLRAP1 is an adapter protein (clathrin-associated sorting protein (CLASP)) required for efficient endocytosis of the LDL receptor (LDLR) in polarized cells such as hepatocytes and lymphocytes, but not in non-polarized cells (fibroblasts). LDLRAP1 may be required for LDL binding and internalization but not for receptor clustering in coated pits. LDLRAP1 may facilitate the endocytocis of LDLR and LDLR-LDL complexes from coated pits by stabilizing the interaction between the receptor and the structural components of the pits. LDLRAP1 may also be involved in the internalization of other LDLR family members. LDLRAP1 binds to phosphoinositides, which regulate clathrin bud assembly at the cell surface.The protein encoded by this gene is a cytosolic protein which contains a phosphotyrosine binding (PTD) domain. The PTD domain has been found to interact with the cytoplasmic tail of the LDL receptor. Mutations in this gene lead to LDL receptor malfunction and cause the disorder autosomal recessive hypercholesterolaemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LDLRAP1

Key Reference: Mameza,M.G., (2007) J. Neurochem. 103 (3), 927-941

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: WTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Low density lipoprotein receptor adapter protein 1

Protein Size: 308

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55308_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55308_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26119
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×