LGALS8 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LGALS8

Key Reference: Yamamoto,H., (2008) J. Biochem. 143 (3), 311-324

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: galectin-8

Protein Size: 359

Purification: Affinity Purified

• Artikelnummer: AVIARP53656_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53656_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3964
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin