LGALS9 Antibody - middle region : FITC

LGALS9 Antibody - middle region : FITC
Artikelnummer
AVIARP54821_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LGALS9

Key Reference: Bi,S., (2008) J. Biol. Chem. 283 (18), 12248-12258

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: galectin-9

Protein Size: 355

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54821_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54821_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3965
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×