Lhpp Antibody - C-terminal region : FITC

Lhpp Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57606_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Lhpp is a phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. It has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Lhpp

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: VGDVGGAQQCGMRALQVRTGKFRPGDEHHPEVQADGYVDNLAEAVDLLLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phospholysine phosphohistidine inorganic pyrophosphate phosphatase

Protein Size: 270

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57606_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57606_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 76429
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×