LIG1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the ATP-dependent DNA ligase protein family. The encoded protein functions in DNA replication, recombination, and the base excision repair process. Mutations in this gene that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents. Disruption of this gene may also be associated with a variety of cancers. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LIG1

Key Reference: Liang,L., (2008) Nucleic Acids Res. 36 (10), 3297-3310

Molecular Weight: 102kDa

Peptide Sequence: Synthetic peptide located within the following region: ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA ligase 1

Protein Size: 919

Purification: Affinity Purified

• Artikelnummer: AVIARP54307_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54307_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3978
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin