LMOD1 Antibody - N-terminal region : FITC

LMOD1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54847_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The leiomodin 1 protein (LMOD1) has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.The leiomodin 1 protein has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LMOD1

Key Reference: Lane,H.Y., (2006) J Clin Psychopharmacol 26 (2), 128-134

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leiomodin-1

Protein Size: 600

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54847_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54847_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25802
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×