LOC100362453 Antibody - C-terminal region : FITC

LOC100362453 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56187_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: EVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 309

Purification: Affinity Purified

Subunit: alpha-like
Mehr Informationen
Artikelnummer AVIARP56187_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56187_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 100362453
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×