Loxl2 Antibody - C-terminal region : FITC

Loxl2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54693_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: NNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lysyl oxidase homolog 2

Protein Size: 776

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54693_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54693_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 94352
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×