LPP Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LPP may play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. LPP may be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. LPP is also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LPP

Key Reference: Jin,L., (2007) Circ. Res. 100 (6), 817-825

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lipoma-preferred partner

Protein Size: 612

Purification: Affinity Purified

• Artikelnummer: AVIARP53640_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53640_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4026
• Wirt: Rabbit
• Konjugat: Conjugated, FITC