LPP Antibody - N-terminal region : HRP

LPP Antibody - N-terminal region : HRP
Artikelnummer
AVIARP53640_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: LPP may play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. LPP may be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. LPP is also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LPP

Key Reference: Jin,L., (2007) Circ. Res. 100 (6), 817-825

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Lipoma-preferred partner

Protein Size: 612

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53640_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53640_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4026
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×