LRRC18 Antibody - N-terminal region : Biotin

LRRC18 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56171_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: LRRC18 may be involved in the regulation of spermatogenesis and sperm maturation.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LRRC18

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: NLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat-containing protein 18

Protein Size: 255

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56171_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56171_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 474354
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×