LRRC18 Antibody - N-terminal region : HRP

LRRC18 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56171_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: LRRC18 may be involved in the regulation of spermatogenesis and sperm maturation.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LRRC18

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: NLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Leucine-rich repeat-containing protein 18

Protein Size: 255

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56171_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56171_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 474354
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×