LRRC23 Antibody - middle region : FITC

LRRC23 Antibody - middle region : FITC
Artikelnummer
AVIARP53487_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LRRC23 contains 5 LRR (leucine-rich) repeats. The exact function of LRRC23 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRRC23

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: ISLHTVELRGNQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat-containing protein 23

Protein Size: 343

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53487_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53487_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10233
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×