LRRC37A3 Antibody - middle region : HRP

LRRC37A3 Antibody - middle region : HRP
Artikelnummer
AVIARP56070_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRRC37A3

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 180kDa

Peptide Sequence: Synthetic peptide located within the following region: NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Leucine-rich repeat-containing protein 37A3

Protein Size: 1634

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56070_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56070_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 374819
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×