LRRC56 Antibody - N-terminal region : Biotin

LRRC56 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP53452_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: LRRC56 contains 3 LRR (leucine-rich) repeats. The exact function of LRRC56 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC56

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat-containing protein 56

Protein Size: 542

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53452_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53452_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 115399
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×