LRRC57 Antibody - N-terminal region : Biotin

LRRC57 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55577_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact function of LRRC57 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC57

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat-containing protein 57

Protein Size: 239

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55577_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55577_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 255252
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×