LRRC6 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: LRRC6 may be involved in spermatocytogenesis or prophase of meiosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRRC6

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein TILB homolog

Protein Size: 466

Purification: Affinity Purified

• Artikelnummer: AVIARP53688_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53688_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23639
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin