LRRC6 Antibody - middle region : HRP

LRRC6 Antibody - middle region : HRP
Artikelnummer
AVIARP53688_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: LRRC6 may be involved in spermatocytogenesis or prophase of meiosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRRC6

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein TILB homolog

Protein Size: 466

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53688_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53688_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23639
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×