LRRN4CL Antibody - middle region : FITC

LRRN4CL Antibody - middle region : FITC
Artikelnummer
AVIARP55964_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC221091

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LRRN4 C-terminal-like protein

Protein Size: 238

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55964_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55964_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221091
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×