LRRTM1 Antibody - middle region : FITC

LRRTM1 Antibody - middle region : FITC
Artikelnummer
AVIARP55787_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRRTM1

Key Reference: Francks,C., (2007) Mol. Psychiatry 12 (12), 1129-1139

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: RIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat transmembrane neuronal protein 1

Protein Size: 522

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55787_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55787_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 347730
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×