LRRTM1 Antibody - middle region : HRP

LRRTM1 Antibody - middle region : HRP
Artikelnummer
AVIARP55788_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRRTM1

Key Reference: Francks,C., (2007) Mol. Psychiatry 12 (12), 1129-1139

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: CALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Leucine-rich repeat transmembrane neuronal protein 1

Protein Size: 522

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55788_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55788_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 347730
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×