LRWD1 Antibody - middle region : FITC

LRWD1 Antibody - middle region : FITC
Artikelnummer
AVIARP55558_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of RAT LOC304396

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: EPLHFLQCHSRNNSPKDLETQLWACAFEPAREEGHSGATSQTVATCGGEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: leucine-rich repeat and WD repeat-containing protein 1

Protein Size: 416

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55558_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55558_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 304396
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×