LTA4H Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: LTA4H hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LTA4H

Key Reference: Bevan,S., (2008) Stroke 39 (4), 1109-1114

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: NACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Leukotriene A-4 hydrolase

Protein Size: 611

Purification: Affinity Purified

• Artikelnummer: AVIARP54368_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54368_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4048
• Wirt: Rabbit
• Konjugat: Conjugated, HRP