LTA4H Antibody - N-terminal region : FITC

LTA4H Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54367_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LTA4H hydrolyzes an epoxide moiety of leukotriene A4 (LTA-4) to form leukotriene B4 (LTB-4). The enzyme also has some peptidase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LTA4H

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: IVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leukotriene A-4 hydrolase

Protein Size: 611

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54367_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54367_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4048
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×