LTB4DH Antibody - N-terminal region : FITC

LTB4DH Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54865_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LTB4DH functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It has no activity towards PGE1, PGE2 and PGE2-alpha. LTB4DH catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LTB4DH

Key Reference: Chou,W.L., (2007) J. Biol. Chem. 282 (25), 18162-18172

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prostaglandin reductase 1

Protein Size: 329

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54865_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54865_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22949
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×