LUC7L Antibody - middle region : Biotin

LUC7L Antibody - middle region : Biotin
Artikelnummer
AVIARP57816_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LUC7L

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LUC7-like (S. cerevisiae) EMBL CAM26672.1

Protein Size: 325

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57816_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57816_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55692
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×