LYPD6 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Members of the LY6 protein family (see SLURP1; MIM 606119), such as LYPD6, have at least one 80-amino acid LU domain that contains 10 conserved cysteines with a defined disulfide-bonding pattern.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LYPD6

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: KAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ly6/PLAUR domain-containing protein 6

Protein Size: 76

Purification: Affinity Purified

• Artikelnummer: AVIARP53450_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53450_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 130574
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin