LYPD6 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LYPD6

Key Reference: Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ly6/PLAUR domain-containing protein 6

Protein Size: 171

Purification: Affinity Purified

• Artikelnummer: AVIARP53451_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53451_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 130574
• Wirt: Rabbit
• Konjugat: Conjugated, FITC