LYPD6 Antibody - middle region : HRP

LYPD6 Antibody - middle region : HRP
Artikelnummer
AVIARP53451_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: LYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LYPD6

Key Reference: Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ly6/PLAUR domain-containing protein 6

Protein Size: 171

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53451_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53451_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 130574
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×