LYRM1 Antibody - middle region : FITC

LYRM1 Antibody - middle region : FITC
Artikelnummer
AVIARP57413_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LYRM1 may promote cell proliferation and inhibition of apoptosis of preadipocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LYRM1

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LYR motif-containing protein 1

Protein Size: 122

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57413_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57413_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57149
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×