Lyrm4 Antibody - middle region : Biotin

Lyrm4 Antibody - middle region : Biotin
Artikelnummer
AVIARP57407_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Lyrm4 is required for nuclear and mitochondrial iron-sulfur protein biosynthesis.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: VRRIRDAFRENKNVKDPVEIQALVNKAKRDLEIIRRQVHIGQLYSTDKLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LYR motif-containing protein 4

Protein Size: 91

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57407_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57407_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 380840
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×