LYSMD1 Antibody - N-terminal region : FITC

LYSMD1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56012_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYSMD1

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: VRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LysM and putative peptidoglycan-binding domain-containing protein 1

Protein Size: 227

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56012_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56012_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 388695
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×