LYSMD2 Antibody - middle region : FITC

LYSMD2 Antibody - middle region : FITC
Artikelnummer
AVIARP55592_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LYSMD2

Key Reference: Rush,J., (2005) Nat. Biotechnol. 23 (1), 94-101

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LysM and putative peptidoglycan-binding domain-containing protein 2

Protein Size: 215

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55592_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55592_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 256586
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×