LYZL6 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: LYZL6 belongs to the glycosyl hydrolase 22 family. The exact function of LYZL6 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYZL6

Key Reference: Zhang,K., (2005) Biol. Reprod. 73 (5), 1064-1071

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lysozyme-like protein 6

Protein Size: 148

Purification: Affinity Purified

• Artikelnummer: AVIARP53746_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53746_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57151
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin