MAGEB2 Antibody - N-terminal region : Biotin

MAGEB2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56336_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB gen

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEB2

Key Reference: Milutinovic,S., (2007) Carcinogenesis 28 (3), 560-571

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Melanoma-associated antigen B2

Protein Size: 319

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56336_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56336_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4113
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×