MAGEB3 Antibody - N-terminal region : FITC

MAGEB3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56338_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognized on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEB3

Key Reference: Ross,M.T., (2005) Nature 434 (7031), 325-337

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: MPRGQKSTLHAREKRQQTRGQTQDHQGAQITATNKKKVSFSSPLILGATI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Melanoma-associated antigen B3

Protein Size: 346

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56338_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56338_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4114
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×