MAGEB3 Antibody - N-terminal region : HRP

MAGEB3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56338_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognized on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEB3

Key Reference: Ross,M.T., (2005) Nature 434 (7031), 325-337

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: MPRGQKSTLHAREKRQQTRGQTQDHQGAQITATNKKKVSFSSPLILGATI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Melanoma-associated antigen B3

Protein Size: 346

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56338_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56338_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4114
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×