MAGEB4 Antibody - N-terminal region : Biotin

MAGEB4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56340_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEB4

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Melanoma-associated antigen B4

Protein Size: 346

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56340_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56340_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4115
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×