MAPK11 Antibody - N-terminal region : Biotin

MAPK11 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56437_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of a family of protein kinases that are involved in the integration of biochemical signals for a wide variety of cellular processes, including cell proliferation, differentiation, transcriptional regulation, and development. The encoded protein can be activated by proinflammatory cytokines and environmental stresses through phosphorylation by mitogen activated protein kinase kinases (MKKs). Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MK11

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: mitogen-activated protein kinase 11

Protein Size: 364

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56437_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56437_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5600
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×