Mapk12 Antibody - C-terminal region : FITC

Mapk12 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56536_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mapk12 responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating downstream targets. Mapk12 plays a role in myoblast differentiation and also in the down-regulation of cyclin D1 in response to hypoxia in adrenal cells suggesting MAPK12 may inhibit cell proliferation while promoting differentiation.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: ERMLVLDAEQRVTAAEALTHPYFESLRDTEDEPKAQKYDDSFDDVDRTLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 12

Protein Size: 367

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56536_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56536_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29857
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×