MAPK13 Antibody - middle region : FITC

MAPK13 Antibody - middle region : FITC
Artikelnummer
AVIARP56440_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK13

Key Reference: Zhou,X., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (14), 5620-5625

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 13

Protein Size: 365

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56440_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56440_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5603
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×