MAPK3 Antibody - middle region : FITC

MAPK3 Antibody - middle region : FITC
Artikelnummer
AVIARP56431_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, a

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK3

Key Reference: Seomun,Y. (2008) Biochem. Biophys. Res. Commun. 372 (1), 221-225

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: LDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 3

Protein Size: 379

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56431_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56431_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5595
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×