MAPK3 Antibody - middle region : HRP

MAPK3 Antibody - middle region : HRP
Artikelnummer
AVIARP56431_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, a

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK3

Key Reference: Seomun,Y. (2008) Biochem. Biophys. Res. Commun. 372 (1), 221-225

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: LDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitogen-activated protein kinase 3

Protein Size: 379

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56431_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56431_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5595
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×