MAPK4 Antibody - middle region : Biotin

MAPK4 Antibody - middle region : Biotin
Artikelnummer
AVIARP56433_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targe

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK4

Key Reference: Murtagh,J.J. (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (19), 6870-6875

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 4

Protein Size: 587

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56433_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56433_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5596
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×