Mapk8ip2 Antibody - middle region : HRP

Mapk8ip2 Antibody - middle region : HRP
Artikelnummer
AVIARP55343_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Mapk8ip2

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: SEPEPEPEPEPLHEPPRRPAFLPVGQDDTNSEYESGSESEPDLSEDADSP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitogen-activated protein kinase 8 interacting protein 2 EMBL EDL76573.1

Protein Size: 835

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55343_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55343_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 315220
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×