MARK3 Antibody - middle region : HRP

MARK3 Antibody - middle region : HRP
Artikelnummer
AVIARP56343_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MARK3 is involved in the specific phosphorylation of microtubule-associated proteins for tau, MAP2 and MAP4. Phosphorylates CDC25C on 'Ser-216'.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MARK3

Key Reference: Murphy,J.M., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (36), 14336-14341

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: MAP/microtubule affinity-regulating kinase 3

Protein Size: 729

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56343_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56343_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4140
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×