MAT2B Antibody - N-terminal region : HRP

MAT2B Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55849_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MAT2B belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT.The protein encoded by this gene belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAT2B

Key Reference: Ramani,K., (2008) Hepatology 47 (2), 521-531

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cDNA FLJ76904, highly similar to Homo sapiens methionine adenosyltransferase II, beta (MAT2B), transcript variant 2, mRNA EMBL BAF84608.1

Protein Size: 323

Purification: Affinity Purified

Subunit: beta
Mehr Informationen
Artikelnummer AVIARP55849_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55849_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27430
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×