MATN2 Antibody - middle region : FITC

MATN2 Antibody - middle region : FITC
Artikelnummer
AVIARP57667_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.This gene encodes a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MATN2

Key Reference: Ichikawa,T., (2008) Biochem. Biophys. Res. Commun. 369 (4), 994-1000

Molecular Weight: 102kDa

Peptide Sequence: Synthetic peptide located within the following region: AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Matrilin-2

Protein Size: 937

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57667_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57667_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4147
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×