MATN3 Antibody - middle region : Biotin

MATN3 Antibody - middle region : Biotin
Artikelnummer
AVIARP56345_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains two

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MATN3

Key Reference: Fresquet,M., Hum. Mutat. 29 (2), 330 (2008)

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Matrilin-3

Protein Size: 486

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56345_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56345_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4148
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×